Protein Info for Dsui_0924 in Dechlorosoma suillum PS

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 169 to 195 (27 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 457 to 478 (22 residues), see Phobius details PF03773: ArsP_1" amino acids 18 to 448 (431 residues), 223.5 bits, see alignment E=1.7e-70

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 74% identity to tmz:Tmz1t_1855)

Predicted SEED Role

"predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIW2 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Dsui_0924 putative permease (Dechlorosoma suillum PS)
MEDLLSLLQALIRGGLGNLAAYLAAHVLLCLLPAFCIAGAMAALIPKETITRFLGRQTPK
TVSYPAAAAAGSVLAVCSCTIVPLFAGIYRKGAGLGPATTFLFFAPAANILALVYTGGII
GVDLAVARLLLSLTFAIGIGLIMALLFRADDSARDRATDALFSAQAAAGLSRGALAFLLV
WIGLLLAGTLKVGLLTGSLWQFDLAWAGSADWQALLDRLVPYDASRGEEGVSLQGVLLIG
LLGGIGLSARLGLENIEAGANGWTRLCLSLVALTLLVAALSVQAVPGGLRLGLGGKFLGV
ALALAVLTWLGSRHLTAEDRRAWLWESWRFVKQIFPLLVIGVFVVGMIRVVLRPEWIEMV
AGSNTLLGNLAGVGFGVFMYFPTLVEVPIAKMFLDLGMHRGPLLAYLMSDPELSLQSILI
ITAIIGRTKTWTYVGLVALFSAAAGLTYGAWVDGAPPLLLVLGIGGAMAGLGLLLAAANR
FSAKGV