Protein Info for Dsui_0917 in Dechlorosoma suillum PS

Annotation: integrase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 PF09299: Mu-transpos_C" amino acids 453 to 514 (62 residues), 32.8 bits, see alignment E=5.7e-12

Best Hits

KEGG orthology group: K07497, putative transposase (inferred from 53% identity to asa:ASA_1043)

Predicted SEED Role

"TniA putative transposase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIV5 at UniProt or InterPro

Protein Sequence (633 amino acids)

>Dsui_0917 integrase family protein (Dechlorosoma suillum PS)
MKDLSPRLILEYGSDVAYRGRRYVICQQPSDFSAISIKDPESGAIFQAAVAELSPYVEKS
KASPGDLATIPEKRAAEANYKYEVIKPLLNMAKRTSADVVAQATKYGLSRSAVYQWLQEF
DRIGKVSVFVRKTRKDAGKKKIPKQLEEIISDAIKTQYLTKQKKKPSAVIIEIERICKKL
EIDPPHPNTVRSRIRQINAYEKKKSREGNKAARDAYAPHKSEFPGADFPLSVVQVDHTPL
DIILVDDAHRQPIGRPWLTLLIDVYSRMILGFYISFDPPGNLSLGLCLTHAFLPKENWLA
KHNIDTPWPCWGTPRTIHADNAKEFRGNMLQQACKEYGIDLEWRPVATPHYGAHIERLLG
TLNREIHNAPGTTFSNLKERGEYDSDKESAMTLTEFERWFAILCVEVYHQRPHSQLGMPP
IAKWQEGILGTKTSPGTGLPPRITDELRLKLDLMPFDTRTVQHYGIVWDHIQYQHDVLRR
WVNATDPNSPKNKRQFLCRRDPRDISVIWFYDPELEDYFAIPYRNTSRPAISLWELRAAE
SRAKQERPDFPIEEDLIFQAYDKLREIEDNAKTMTKKVRRSRERSRVGINNARAHIPPIS
PKAKPHPSQSKAPPARVIKPFEDMDDMQGDDDD