Protein Info for Dsui_0916 in Dechlorosoma suillum PS

Annotation: TniB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF05621: TniB" amino acids 24 to 213 (190 residues), 255 bits, see alignment E=5.5e-80 PF13401: AAA_22" amino acids 60 to 190 (131 residues), 40.6 bits, see alignment E=4.7e-14 PF00004: AAA" amino acids 61 to 207 (147 residues), 22.3 bits, see alignment E=2.4e-08

Best Hits

KEGG orthology group: None (inferred from 64% identity to asa:ASA_1044)

Predicted SEED Role

"TniB NTP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIV4 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Dsui_0916 TniB protein (Dechlorosoma suillum PS)
MMTEPRSHLLKKAAAYLDRPDEERIAYIRSPRWIGYPRAQEALSKLEELLNYPQSHRMPN
LLIIGDTNNGKTMLVQRFCKQHKPADNPEGEAAIVPVLYVQAPPVPDEGRFYNAILELLF
APYKPGDRADRKQFQAIKVMKAVGLKMLLIDEIHHILAGSMTKQKAFLNVIKYLGNELEI
PIVGIGTKDAFRAIQTDLQLSNRFDHINIPRWHNDDDFLRLLASFEQAIPLRNPSDLVNG
PLADKIYSMTEGYLGELSRLLVKAAVQAVASGRELIDKRILDGLGWTPPSERRKEPRG