Protein Info for Dsui_0903 in Dechlorosoma suillum PS

Annotation: lipoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 86% identical to LIPA_DECAR: Lipoyl synthase (lipA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 86% identity to dar:Daro_0287)

MetaCyc: 63% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

lipoate biosynthesis and incorporation I (2/2 steps found)
lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIE9 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Dsui_0903 lipoate synthase (Dechlorosoma suillum PS)
MSSERGVKQKGELKTARIPIKIVPVEETLKKPSWIRVKAGNDAGRFGEIKQLLREQKLHT
VCEEAACPNIGECFGRGTATFMILGDICTRRCPFCDVGHGKPLPPDPLEPAHLAESVSKL
KLKYVVITSVDRDDLRDGGAQHFVDVIKAVRESSPKTTIETLVPDFRGRLEVAVDVLGQG
LPDVLNHNLETVPRLYKQARPGADYEHSLQFLKQFKARYPQVPTKSGLMVGLGETDEEIL
EVMRDLRAHDVELLTIGQYLAPSNHHLPVQRYVHPDVFKMYEEKAKEMGFSGAACGAMVR
SSYWADQQAHTAGVV