Protein Info for Dsui_0897 in Dechlorosoma suillum PS

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 63 to 387 (325 residues), 155.7 bits, see alignment E=7.2e-50 PF25973: BSH_CzcB" amino acids 87 to 238 (152 residues), 54.3 bits, see alignment E=2.1e-18 PF25954: Beta-barrel_RND_2" amino acids 242 to 317 (76 residues), 78 bits, see alignment E=1e-25 PF25975: CzcB_C" amino acids 323 to 383 (61 residues), 35.8 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: None (inferred from 60% identity to rme:Rmet_4121)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIE3 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Dsui_0897 RND family efflux transporter, MFP subunit (Dechlorosoma suillum PS)
MSAPAPQSPHSARRLAPAFTALLLAAGVSLLTACGKEPAPVAAAPTDPNLVTAPEALQAQ
LKLAPVGSVPVSETLRVAGRLDFDEQRIARIGATVTGRVTQISGQLGHEVKAGEPLAIIN
STVLGEAQLTFLKANARASLERNNVERAQHLFAADVIGKAELQRRESEAAVTQAERQAAE
DQLRVLGMAPRDIASLASRGTINSLTPVVASIPGTLVERKVTQGQVVEPADALFTVADLS
RLWAVADVPEQQAALVRTGQSVELDIPSLAGEKLTGRLIYISDTLNPETRTVLVRTEVEN
PDRRLKPAMLATMLIAGKAMPKLAVPAAAVVREDNNEHVFVQVAPGQYRLTPVILGAEAG
GVRPVQSGLKEGEVVVVEGAFHLNNERKRKELEGS