Protein Info for Dsui_0892 in Dechlorosoma suillum PS

Annotation: rod shape-determining protein RodA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 113 to 128 (16 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 303 to 330 (28 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 17 to 361 (345 residues), 433.9 bits, see alignment E=2.4e-134 PF01098: FTSW_RODA_SPOVE" amino acids 25 to 361 (337 residues), 357.6 bits, see alignment E=3.6e-111

Best Hits

Swiss-Prot: 33% identical to FTSW_METMM: Probable peptidoglycan glycosyltransferase FtsW (ftsW) from Methylomonas methanica (strain MC09)

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 74% identity to dar:Daro_0112)

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QID8 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Dsui_0892 rod shape-determining protein RodA (Dechlorosoma suillum PS)
MEAIRRYWYKAIEHLDGPLLTIALVILGIGTATVYSATYIGLSRMGPQAVNLLIAFSVMW
MVAQVPPQKLLRFAVPLYVLGVILLLAVWLFGIKVNGARRWLHVGVTRIQPSEIMKIAMP
LMLAWYFHKHEAALRWRHYATASMLLLVPVAFIIKQPDLGTAILVLAAGFYVIFFAGLSW
KVIVGLIAAGAAAAPFAWTMLHDYQRKRILTLIDPTSDPLGTGYHIIQSTIAIGSGGIIG
KGWLNGTQTHLEFIPEKHTDFIFAVFSEEWGLIGNLVLLLLYLLLIGRCMMIAANAPTLS
SRLLAGAISLNFFTYAFVNMGMVSGILPVVGVPLPFVSYGGTALVTLFLGLGILMSIHTH
RMLVKK