Protein Info for Dsui_0891 in Dechlorosoma suillum PS

Annotation: penicillin-binding protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details TIGR03423: penicillin-binding protein 2" amino acids 19 to 613 (595 residues), 799.3 bits, see alignment E=1.1e-244 PF03717: PBP_dimer" amino acids 63 to 238 (176 residues), 149.3 bits, see alignment E=1.7e-47 PF00905: Transpeptidase" amino acids 271 to 609 (339 residues), 252.1 bits, see alignment E=6.9e-79

Best Hits

KEGG orthology group: K05515, penicillin-binding protein 2 (inferred from 74% identity to app:CAP2UW1_0695)

Predicted SEED Role

"Penicillin-binding protein 2 (PBP-2)" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QID7 at UniProt or InterPro

Protein Sequence (633 amino acids)

>Dsui_0891 penicillin-binding protein 2 (Dechlorosoma suillum PS)
MRYTDLSSSDREQEQFRFRLGFAAGMVLLCFVILFARFFWLQVVKHDYYSTRAEENRISL
VPIIPNRGLIVDRNGVVMARNYSAFTLEITPSRLQEDLETVIEQIGTLIPITPKDRKRFK
KLMEESKNFESIPIRTRLSDDEVARFAANRYRFPGVEVKARLFRQYPLGDVASHALGYMG
RINDKDLETIDNAEQTPNYKGTEHIGKAGLEQNYEFQLHGETGYEEVEVDAGGRAVRVLS
RTAPVSGNNLSLTLDSKLQEITEQAFGSRRGALVAIEPSTGGILALVSKPTYDPNLFVDG
IRGDDWDGLNTDPDKPLLNRAIYSAYPPGSTFKPFMALAALVQGKRTPSQAIADPGYFNF
GGHQFRDDKKGGHGMVDMYKSIVESCDTYYYILANDMGIDNIAAFMGQLGLGQRTGVDIQ
GESEGVLPSQAWKKRRFKKPEHQKWYAGETISIGIGQGYNAYTPIQLAQAVATIANDGVM
YRPHLVKYITNSRSGEKTMVEPQPIRDLKLKPEHLAVIKNAMVGVNKAGTGARAFAGAGY
ESAGKTGTAQVFSLKGEKYVEGATKHHLRDHSLFIAYAPAEQPKIALAVIVENGGFGAAA
AAPIARMVLDYYILGKVPKGPANEDEEGDDGGH