Protein Info for Dsui_0890 in Dechlorosoma suillum PS

Annotation: rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details TIGR03426: rod shape-determining protein MreD" amino acids 15 to 158 (144 residues), 107.4 bits, see alignment E=3.4e-35 PF04093: MreD" amino acids 16 to 152 (137 residues), 61.8 bits, see alignment E=4.5e-21

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 72% identity to dar:Daro_0114)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QID6 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Dsui_0890 rod shape-determining protein MreD (Dechlorosoma suillum PS)
MQPTFTSSRILLPVRPWFITLTLVLALLLNLMPTAHWPGVPDWVALVLCFWSVREFRKVS
MGWSFILGLAMDVADGSLMGQHALAYVLMSYIASSLSRRILWFPLLQQALQVFPLLFMVQ
VLQLAARMATGAAFPGFGYLIGPLVAALLWVPATYVLLLPQYQPVERDENRPI