Protein Info for Dsui_0878 in Dechlorosoma suillum PS

Annotation: heme/copper-type cytochrome/quinol oxidase, subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 147 to 152 (6 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details PF00510: COX3" amino acids 80 to 209 (130 residues), 31.3 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 67% identity to dar:Daro_1065)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIC4 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Dsui_0878 heme/copper-type cytochrome/quinol oxidase, subunit 3 (Dechlorosoma suillum PS)
MEAVIKPEIDIGGLGQSGPGHSLAQGRGWIPGNKGIWVGITCEFVEFALMFAVYFIARAH
YPEAFANGSELLNKTAGTTITVLMVTSSFFVACAVAALRAGRPRRQAVLWLVAALVVALG
YPVVKVYEITGNLAQGIDGSAGIFYTVYYYLTFNHLVHASWGILGMLWVLVRLVLGGYSR
EDHSGLEALASYWHATDIIWLILYPLFYVLA