Protein Info for Dsui_0871 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 transmembrane" amino acids 86 to 104 (19 residues), see Phobius details PF05957: DUF883" amino acids 15 to 63 (49 residues), 47.4 bits, see alignment E=1.4e-16 PF19029: DUF883_C" amino acids 77 to 106 (30 residues), 60.1 bits, see alignment E=1.3e-20

Best Hits

Swiss-Prot: 36% identical to YQJD_ECOL6: Uncharacterized protein YqjD (yqjD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 76% identity to app:CAP2UW1_0685)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIB7 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Dsui_0871 hypothetical protein (Dechlorosoma suillum PS)
MNANTDLSAVSKEKLVTDLKVVVADAEELLRATASSAGEKVSELREKIQDRLRDAKIRLA
DAEAALVDKTKAAARATDDFVHENPWKAVGIAAGVGLLLGVIIGRR