Protein Info for Dsui_0849 in Dechlorosoma suillum PS

Annotation: ParB-like partition protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 24 to 195 (172 residues), 196.7 bits, see alignment E=1.5e-62 PF02195: ParBc" amino acids 29 to 116 (88 residues), 104.6 bits, see alignment E=3.8e-34 PF17762: HTH_ParB" amino acids 167 to 215 (49 residues), 66.8 bits, see alignment 1.8e-22 PF23552: ParB_dimer" amino acids 228 to 277 (50 residues), 72.5 bits, see alignment 2.2e-24

Best Hits

Swiss-Prot: 52% identical to PARB_PSEPU: Probable chromosome-partitioning protein ParB (parB) from Pseudomonas putida

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 72% identity to app:CAP2UW1_4360)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI95 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Dsui_0849 ParB-like partition protein (Dechlorosoma suillum PS)
MKMKGLGRGLDALLAGDAADAKKDQQRTLPIDALKPGKYQPRTRMDEGSLKELAASIQAQ
GIMQPILVRPINGGYEIIAGERRWRACRMAGMTEVPTLVREIPDEAAAAMSLIENIQREN
LNPLEEAMGLQRLVDEFEMTHQQAADAVGRSRPAASNLLRLLQLAAPVQELLLEGKLDMG
HARALLSLEGAEQIQVGNRVAHKGLSVRETERLVQALLNPPKKVEKAKDRDLLRLEEELS
DLLGAKVTVAANRKGAGKMAIEFSSLDQLDELLARFR