Protein Info for Dsui_0843 in Dechlorosoma suillum PS

Annotation: branched-chain amino acid ABC-type transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 333 (321 residues), 72.6 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 72% identity to app:CAP2UW1_4467)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI89 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Dsui_0843 branched-chain amino acid ABC-type transport system, permease component (Dechlorosoma suillum PS)
MDLQILLLLGQDGLTNGAIYALLALALVLVFAVTRVIFLPQGEFVAYGALTLAAIQAGKL
PGTVWLAVILGIAVVLIDGGLALKSGNLKRLPRIVLGNLGLPLVLLGLISGLEAEALAAL
ALPLQILLTLGIVVPLGPLLYRLVFQPIAEASSLVLLIVAVALHMTLIGLGLVFFGAEGF
RTQPFSDGALEIGPLLLQHQTLWILFASAALIAVLYVLFERTVYGKALRATALNRTGARL
MGISTTMAGKLSLGLAAFIGALSGVLVSPMTTLYYDSGFLIGLKGFVGAIIGGLASYPVA
ALGAVLVGLLESYSSFYASAFKEVIVFTLIIPVLVWRSLTSHHVEEEEE