Protein Info for Dsui_0837 in Dechlorosoma suillum PS

Annotation: tRNA modification GTPase TrmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF10396: TrmE_N" amino acids 8 to 120 (113 residues), 134.6 bits, see alignment E=3.8e-43 TIGR00450: tRNA modification GTPase TrmE" amino acids 12 to 450 (439 residues), 347.2 bits, see alignment E=1.7e-107 PF12631: MnmE_helical" amino acids 123 to 447 (325 residues), 190.9 bits, see alignment E=6.3e-60 TIGR00231: small GTP-binding protein domain" amino acids 217 to 367 (151 residues), 83 bits, see alignment E=2e-27 PF01926: MMR_HSR1" amino acids 218 to 332 (115 residues), 87 bits, see alignment E=2.1e-28 PF02421: FeoB_N" amino acids 218 to 338 (121 residues), 34.4 bits, see alignment E=3.2e-12

Best Hits

Swiss-Prot: 76% identical to MNME_DECAR: tRNA modification GTPase MnmE (mnmE) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 76% identity to dar:Daro_4200)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHU2 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Dsui_0837 tRNA modification GTPase TrmE (Dechlorosoma suillum PS)
MMPRTDPIAAIATAPGRGGVGVVRISGSGLLPLAEQLTGRLPRPRHATLADFRAADGSVI
DSGLLLFFPNPSSFTGEDVLELQGHGGPVVLQMLLARCLDLGARLAEPGEFTRRAFLNGK
LDLAQAEAVADLIDATTQAAARSAVRSLQGEFSREIRVLTDELIELRALTEATLDFPEEE
IDFLKAANAFGRLDSLAARLEAVFDRARQGRLLQNGLHVVLAGQPNVGKSSLLNGLAGDE
LAIVTPIAGTTRDVVRGNLQIEGIPLHVIDTAGLRETEDEVERLGIERTWREIEKADVLV
LLADAREGIAHGEEAILRRLPPDLPRITVYNKIDLTDRAPERHEEPEGGEGCVAISLSAK
SGAGLDLLRRELLRIAGWHEAEDVFIARERHLRALAAAQEHLQLSRQRLPALELFAEELR
LAQNALCHITGEFTADDLLGEIFGRFCIGK