Protein Info for Dsui_0822 in Dechlorosoma suillum PS

Annotation: DNA-binding ferritin-like protein (oxidative damage protectant)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF00210: Ferritin" amino acids 19 to 157 (139 residues), 98.5 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 54% identical to Y1894_SYNY3: Uncharacterized protein slr1894 (slr1894) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K04047, starvation-inducible DNA-binding protein (inferred from 78% identity to eba:ebA1978)

Predicted SEED Role

"Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1)" in subsystem Oxidative stress (EC 1.16.3.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHS8 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Dsui_0822 DNA-binding ferritin-like protein (oxidative damage protectant) (Dechlorosoma suillum PS)
MATKIDIGITEKDRKKIADGLSHLLADSYILYLKTHNFHWNVTGPMFQTLHTMFMTQYTE
LWNSLDLIAERIRALGYPAPGSYKRFVELASITEEDGVPKAKDMIRQLVAGQEAVARTAR
QVFAVVDKANDQPTADLLTQRMEVHEKNAWMLRVLLEE