Protein Info for Dsui_0813 in Dechlorosoma suillum PS

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 197 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 9 to 288 (280 residues), 250.3 bits, see alignment E=1.2e-78 PF01545: Cation_efflux" amino acids 12 to 205 (194 residues), 148.6 bits, see alignment E=2e-47 PF16916: ZT_dimer" amino acids 209 to 286 (78 residues), 77.1 bits, see alignment E=8.7e-26

Best Hits

Swiss-Prot: 56% identical to Y1263_SYNY3: Uncharacterized transporter sll1263 (sll1263) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 66% identity to tbd:Tbd_1114)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHR9 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Dsui_0813 cation diffusion facilitator family transporter (Dechlorosoma suillum PS)
MHTNTSLTRYAWLSIAAAIATILLKGAAWWWTGSVGLLSDALESFVNLAGALMALWMLTL
AAQPPDEKHAYGHSKAEYFASGFEGLLILVAALAIAHTAINRLLNPQALEQVGVGLAISV
VASLVNLGVARVLLAAGKQYGSVALKADSAHLMTDVWTSVGVIAGVAAVALTGWLWLDPI
LALIVATHILYTAWHLIRDAAAGLMDAALPEEFLGSLESTLLPHRQQGIGFHAIRTRQAG
TRAFISLHVLVPGEWTVQRAHELAEQVEEDIRRAIPGAHVTTHLEPLEDPLSHQDIDLDR