Protein Info for Dsui_0810 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details PF00672: HAMP" amino acids 295 to 346 (52 residues), 50.5 bits, see alignment 3.1e-17 PF00512: HisKA" amino acids 485 to 553 (69 residues), 45.7 bits, see alignment E=8.2e-16 PF02518: HATPase_c" amino acids 593 to 704 (112 residues), 85.6 bits, see alignment E=4.8e-28

Best Hits

KEGG orthology group: None (inferred from 69% identity to app:CAP2UW1_0049)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHR6 at UniProt or InterPro

Protein Sequence (706 amino acids)

>Dsui_0810 signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation (Dechlorosoma suillum PS)
MRVLLVIVAALGGILLFLLASASANTALFARNYPWLLALNGLVALALAGLVAWQLRALWK
EHRAKVFGSRLKLRLLVFFALMGVVPGVTIYAVSVQFVTKSIESWFDVRVETALESGLNL
GRSALDAMLSDLTEKGRQMAQELADRPDGTRRLLLNRLRDQAGVESAALFAANGQVIASA
NGDYSSLLPSLPSSAQLKQARLSRGIGSIEGEGKDMTLRVLVGIPGYGLTEEPRILQLTQ
GVPPAIAENADAVQDVYRDYQELSLARSGLTHIYALTLTLALLLSLFTAIAVAYVLARRL
SAPLSILAEGTQAVAAGDFTPRQAIYSRDELGVLTQSFNQMTRQLDDARKETERHRSELE
SARAYLEEILANLSAGVLAFDARFVLRAINAGASTILGDDFVGLSGEPVEAWPRQNLLGR
AIRDGFAAHPEEDWQTQVELDRPGLAPQVLLLRGSKLPAGSGGGYVVVFDEVTQLIAAQR
SAAWGEVARRLAHEIKNPLTPIQLSAERLQMKLEDKLDAAAAETLNKGTQTIINQVQAMK
RMVDDFRDYARMPSPVLAVLDLNALVGEVLGLYETSHASIDVHLAGDLPPVLGDATQLRQ
IIHNLLRNAEDALAEQPAPAIRLATEPAGRFARLVVEDNGPGFPAEILARAFEPYVTTKP
KGTGLGLAIVRKIVDEHGGRIDITNKHENGTGGGAQISIRLPLANP