Protein Info for Dsui_0806 in Dechlorosoma suillum PS

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF01208: URO-D" amino acids 5 to 351 (347 residues), 453.8 bits, see alignment E=1.9e-140 TIGR01464: uroporphyrinogen decarboxylase" amino acids 9 to 350 (342 residues), 423.9 bits, see alignment E=2.1e-131

Best Hits

Swiss-Prot: 83% identical to DCUP_DECAR: Uroporphyrinogen decarboxylase (hemE) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 83% identity to dar:Daro_0032)

MetaCyc: 60% identical to uroporphyrinogen decarboxylase (Escherichia coli K-12 substr. MG1655)
Uroporphyrinogen decarboxylase. [EC: 4.1.1.37]

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHR2 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Dsui_0806 uroporphyrinogen decarboxylase (Dechlorosoma suillum PS)
MTRPRNDTFLRALLQEPTDYTPLWLMRQAGRYLPEYRETRARAGSFLDLCKNPALACEVT
LQPLARYDLDAAILFSDILTVPDAMGLGLYFAEGEGPKFERPLREEWAIRDLQAPDPYEH
LRYVTDAVSEIRRALDNSVPLIGFSGSPYTLSCYMVEGGSSDDYRHVKTMLYNRPDLMHR
ILSVTADAVTSYLNAQIEAGAQAVMIFDSWGGGLSAAAYEEFSLQYMRRIVAGLTKEKDG
EKIPCIVFTKGGGLWIEKIAAIGCDAVGLDWTIDIGEARRRTNGKVALQGNLDPNVLFAS
PEVVQAEAKKVLDSYHAAGGSKTGHVFNLGHGISQFTPPDHVTALVEAVHGHSRKLRQQG