Protein Info for Dsui_0801 in Dechlorosoma suillum PS

Annotation: transcriptional regulator/sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF00480: ROK" amino acids 3 to 296 (294 residues), 261.2 bits, see alignment E=7.5e-82

Best Hits

Swiss-Prot: 55% identical to MAK_ECOLI: Fructokinase (mak) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 72% identity to dar:Daro_0037)

MetaCyc: 55% identical to fructokinase (Escherichia coli K-12 substr. MG1655)
Mannokinase. [EC: 2.7.1.7]; Fructokinase. [EC: 2.7.1.7, 2.7.1.4]

Predicted SEED Role

"ROK family Glucokinase with ambiguous substrate specificity"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.4 or 2.7.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHQ7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Dsui_0801 transcriptional regulator/sugar kinase (Dechlorosoma suillum PS)
MRLGIDLGGSKIEIIALGDDGRELLRRRVPTPRGDYGATLQAVAGLVREAEAALQMTGSV
GVGMPGSESILSGHIRNANSTCLIGQPLGRDLEALLQRPVRLANDANCFALSEAMDGAGR
GARCVFGVILGTGVGGGLVIDGQVLRGANGIAGEWGHIPLPGAGADDLPLPPCYCGRHGC
VETYLSGPALAADHQRHGGEAMEAAAIATAAATGDARCEAALQRYEARLARALATVMNIV
DPDVIVLGGGLSNLQRLYANVPRLWAPHVFSDHIATRLLPPVHGDSSGVRGAAWLW