Protein Info for Dsui_0801 in Dechlorosoma suillum PS

Annotation: transcriptional regulator/sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00480: ROK
  • amino acids 3 to 296 (294 residues), 261.2 bits, E=7.5e-82

Best Hits

Swiss-Prot: 55% identical to MAK_ECOLI: Fructokinase (mak) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 72% identity to dar:Daro_0037)

MetaCyc: 55% identical to fructokinase (Escherichia coli K-12 substr. MG1655)
Mannokinase. [EC: 2.7.1.7]; Fructokinase. [EC: 2.7.1.7, 2.7.1.4]

Predicted SEED Role

"ROK family Glucokinase with ambiguous substrate specificity"

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• D-mannose degradation II (2/2 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• mannitol degradation II (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• D-sorbitol degradation I (2/3 steps found)
• 1,5-anhydrofructose degradation (3/5 steps found)
• sucrose degradation III (sucrose invertase) (2/4 steps found)
• sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
• mannitol cycle (2/5 steps found)
• CMP-2-keto-3-deoxy-D-glycero-D-galacto-nononate biosynthesis (1/4 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)
• heterolactic fermentation (11/18 steps found)
• superpathway of CMP-sialic acids biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.4 or 2.7.1.7

Sequence Analysis Tools

See G8QHQ7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Dsui_0801 transcriptional regulator/sugar kinase (Dechlorosoma suillum PS)
MRLGIDLGGSKIEIIALGDDGRELLRRRVPTPRGDYGATLQAVAGLVREAEAALQMTGSV
GVGMPGSESILSGHIRNANSTCLIGQPLGRDLEALLQRPVRLANDANCFALSEAMDGAGR
GARCVFGVILGTGVGGGLVIDGQVLRGANGIAGEWGHIPLPGAGADDLPLPPCYCGRHGC
VETYLSGPALAADHQRHGGEAMEAAAIATAAATGDARCEAALQRYEARLARALATVMNIV
DPDVIVLGGGLSNLQRLYANVPRLWAPHVFSDHIATRLLPPVHGDSSGVRGAAWLW