Protein Info for Dsui_0790 in Dechlorosoma suillum PS

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 69% identical to MURB_DECAR: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 67% identity to app:CAP2UW1_0213)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)
peptidoglycan recycling I (8/14 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHP6 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Dsui_0790 UDP-N-acetylenolpyruvoylglucosamine reductase (Dechlorosoma suillum PS)
MLPTFLQADADLQALNTLALPGRAAFLGTITATAQLAALSAVPALQGKPRFILGGGSNLV
LNGDFPGLVLRLAIPGRELAAEDDEAWYIRAGAGENWHDFVRWTLTAGYPGLENLSLIPG
TVGAAPIQNIGAYGLEVGERFHHLEAVDLTTGAAVRFDRHQLRFGYRDSLFKQEGWHLDG
RYAITHVTFRLEKRWQAVTRYADVAKELAAAGIAAPTALQVSDAIIAIRQRKLPDPAQMP
NAGSFFHNPVVDAAIAARLAAEYPTLPQYPQHDGRVKLAAGWLIEQAGWKGRNLGPAGMY
EKQALVLVNRGGATGADVGAVMGAVQASVREKFGVGLTPEPIFL