Protein Info for Dsui_0788 in Dechlorosoma suillum PS

Annotation: phosphosulfolactate phosphohydrolase-like enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 119 to 139 (21 residues), see Phobius details PF04029: 2-ph_phosp" amino acids 20 to 172 (153 residues), 102.6 bits, see alignment E=9.1e-34

Best Hits

KEGG orthology group: K05979, 2-phosphosulfolactate phosphatase [EC: 3.1.3.71] (inferred from 60% identity to app:CAP2UW1_2479)

Predicted SEED Role

"Probable 2-phosphosulfolactate phosphatase (EC 3.1.3.71)" (EC 3.1.3.71)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHP4 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Dsui_0788 phosphosulfolactate phosphohydrolase-like enzyme (Dechlorosoma suillum PS)
MPPPLVERRYLNRLSAAPEPTGAVVVIDVLRSFSTAAWAIHRGARELYPVAAPGDGLLLL
QHLPQALLVGAVGGGAPIPGYHYGNSPSAVQGAELQGRTLIHCTAAGVRGLSRYRTAPLL
FGAALLNARATAAVILAAGVPRVTLVITGEWTDRDGDEDVACADYLEALLQGGDPSPEPF
SERVRQSDFGRRFAAGDQPHLPPADLDLCAEANRFDFALQALPSPLGLRLVAVYAGGGTM
GKSRS