Protein Info for Dsui_0783 in Dechlorosoma suillum PS

Annotation: acetyltransferase, N-acetylglutamate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF00583: Acetyltransf_1" amino acids 23 to 133 (111 residues), 53.9 bits, see alignment E=3.1e-18 PF13673: Acetyltransf_10" amino acids 29 to 136 (108 residues), 57.2 bits, see alignment E=2.7e-19 PF13508: Acetyltransf_7" amino acids 60 to 134 (75 residues), 49.5 bits, see alignment E=6.8e-17

Best Hits

KEGG orthology group: K03830, putative acetyltransferase [EC: 2.3.1.-] (inferred from 54% identity to rso:RS05473)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHN9 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Dsui_0783 acetyltransferase, N-acetylglutamate synthase (Dechlorosoma suillum PS)
MVHIRSVIPGEELELLAVFRRSVHDLAARDYTAVQLDAWAPLTTDADYDAQWIARIQANR
PYVAEIEGAPVGFADLQPSGYIDQFFVDGDCAGQGVGGRLMRHLLNTARTQGLRHLHSHV
SLTAQPFFRHFGFVVEQVQYPVVRGVALENAVMSRLVG