Protein Info for Dsui_0782 in Dechlorosoma suillum PS

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01851: N-acetyl-gamma-glutamyl-phosphate reductase
  • amino acids 3 to 311 (309 residues), 431.3 bits, E=1.1e-133
• PF01118: Semialdhyde_dh
  • amino acids 40 to 101 (62 residues), 36.2 bits, E=7.1e-13
• PF22698: Semialdhyde_dhC_1
  • amino acids 118 to 292 (175 residues), 93.4 bits, E=1.5e-30

Best Hits

Swiss-Prot: 58% identical to ARGC_RALSO: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 58% identity to rso:RSc0142)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• L-ornithine biosynthesis I (4/5 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

See G8QHN8 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Dsui_0782 N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form (Dechlorosoma suillum PS)
MTFKVFIDGRHGTTGLKIDERLSIRPEIEILTIPEDKRKDPAVKAEYINSADVVFLCLPD
AASRESVALLAPGNTRTRFLDASTAHRTNPDWVYGLPELNGGQRERVAKAQKVAVPGCHA
SGFIMLMAPLVAGGIVPKDYPVSTYSITGYSGGGKEMIASYEEPASLPDAMKSPRFYALG
LTHKHLPEMQMQTGLAHQPLFTPIVGNFAQGMVVAVPLLPRMLGKKVTPADLQAFYSEYY
AGEVFVKVMPLDAAPVLDNGFLPATACNDTNRAEIFVFGHGEQILVASRFDNLGKGASGA
AIQCMNLMLGVDEATGLAV