Protein Info for Dsui_0771 in Dechlorosoma suillum PS

Annotation: site-specific recombinase, DNA invertase Pin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00239: Resolvase" amino acids 7 to 141 (135 residues), 124.9 bits, see alignment E=2.9e-40 PF02796: HTH_7" amino acids 143 to 186 (44 residues), 33.9 bits, see alignment 2.8e-12

Best Hits

Swiss-Prot: 59% identical to TNR7_ECOLX: Transposons Tn1721 resolvase (tnpR) from Escherichia coli

KEGG orthology group: None (inferred from 71% identity to dar:Daro_3523)

Predicted SEED Role

"resolvase family recombinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHM8 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Dsui_0771 site-specific recombinase, DNA invertase Pin (Dechlorosoma suillum PS)
MKQNGQAVGYIRVSTEDQNTARQLEGVELTKTFTDRLSGKDTNRPALKECLAYLREGDTL
HIHSLDRLARNLDDLRGIIKGLTGRGVAVRAHKEGLLFTGDDSPMANLLLSMLGAVAEFE
RSIIKERQREGIAIAKQKGVYKGRKASLSEEQVVELKALAASGEKKAALAKRYRVSRASI
YNYLTA