Protein Info for Dsui_0763 in Dechlorosoma suillum PS

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 66 to 87 (22 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 64 to 464 (401 residues), 452.5 bits, see alignment E=6.9e-140 PF00909: Ammonium_transp" amino acids 66 to 464 (399 residues), 407.5 bits, see alignment E=2.6e-126

Best Hits

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 80% identity to aaa:Acav_0289)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH80 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Dsui_0763 ammonium transporter (Dechlorosoma suillum PS)
MKRFLAVLALFGVVGLSAAPAFADDKPEAPVAAATEAAPAAAPAAPAAEAPAAPAAEPKL
DTGDTAWMLTSTMLVILMTIPGLALFYGGLARSKNMLSVLMQIFVIFSLITVLWCIYGYS
LAFSGEGKFFGDLSKAFLKGIAPDTLSGVLPTIPEYVFLIFQSTFAAITTALIVGSYAER
IKFSAVVLFSVLWFTFSYVPMAHIVWGGGLLGADGALDFAGGTVVHINAGVAGLVGAYVL
GKRIGFGKESLAPHSLTLTMVGASLLWVGWFGFNAGSAGAANGIAGLAFVNTVVATGAAT
LSWILGEALFKGKPSMLGAVSGAVAGLVAVTPAAGFVGPMGSIILGLIAGLVCLWGVSGL
KRLLGADDAFDVFGVHGVGGIIGAILTGVFADQSLGGTGGLTPDTFSMGAQVVIQIKSVL
FTVVWSGVVSLVAYKLVDMFVGLRVSEEEEREGLDVASHGESAYHL