Protein Info for Dsui_0751 in Dechlorosoma suillum PS

Annotation: Eco57I restriction endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF07669: Eco57I" amino acids 85 to 180 (96 residues), 61.5 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: K07317, adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 64% identity to app:CAP2UW1_0672)

Predicted SEED Role

"modification methyltransferase"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH68 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Dsui_0751 Eco57I restriction endonuclease (Dechlorosoma suillum PS)
MAECAEPVAPPVALAHDIIRLGQVFTPPDIVTRMLALRRNAGRVLEPACGDGAFLARLPG
AVGIEVDGRHAPAGATVMDFFAYPVSEQFHTIIGNPPYVRFQDIPAPTRARLSLDHFDGR
SNLYLFFIEKCLRHLAPGGELIFITPRDFLKATSAVGMNRLLHAAGSITDFIDLGDARVF
PGATPNCVIWRFEKGDFSRRTRYEAGGQVEERHFQCSGGHLAFTREPCPVRLRDVFYVKV
GAVSGADDLYASAEHGNQDFVCARTARTGQTRRMIYDVRHPLLEPHRERLIQRRIRRFDE
SNWWKWGRSCHLSDGPRIYVNGKTRVDRPFFLHPCRYYDGAVLALFPHDPTVDVQVLCDM
LNAVDWEAQGFVCDGRFLFAQRALEQALLPQAFAPFARRPGAA