Protein Info for Dsui_0741 in Dechlorosoma suillum PS

Annotation: homoserine O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR01392: homoserine O-acetyltransferase" amino acids 19 to 369 (351 residues), 472.4 bits, see alignment E=4.3e-146 PF00561: Abhydrolase_1" amino acids 48 to 357 (310 residues), 75.5 bits, see alignment E=2.8e-25

Best Hits

Swiss-Prot: 81% identical to METXS_AZOSB: Homoserine O-succinyltransferase (metXS) from Azoarcus sp. (strain BH72)

KEGG orthology group: K00641, homoserine O-acetyltransferase [EC: 2.3.1.31] (inferred from 81% identity to azo:azo3971)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH58 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Dsui_0741 homoserine O-acetyltransferase (Dechlorosoma suillum PS)
MSDKHSVGVVSPQRAHFAEPIQLASGATLAAYDLVYETYGRLNADRSNAVLVCHALSGSH
HVAGHYADNPKNVGWWDNLVGPGKPLDTDKFFVVGVNNLGGCYGSTGPGSINPATGKPYG
ADFPVVTVEDWVESQARLADRLGINQWAAIIGGSLGGMQALQWSLEYPERVRHALVIASA
PKLTAQNIAFNEVARQAILTDPDFHGGNYYEHGVVPARGLRLARMVGHITYLSDDQMGEK
FGRQLREGVLKYNYDVDFEIESYLRYQGDKFAGFFDANTYLITTKALDYFDPARDFGGDL
KAALARASAKFLLVSFTTDWRFAPERSREMVYALLHNNREVSYAEIDCNAGHDSFLLDDA
QYHAVMGAYLHNIAV