Protein Info for Dsui_0735 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 63% identity to azo:azo0482)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH52 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Dsui_0735 putative membrane protein (Dechlorosoma suillum PS)
MGAEHHIGARSFFPPLLMPDWFADPAAGLGGLFIASFLAATLLPGGSEAALAAFLLAHPA
EVPAALFWATLGNTLGGLTSYGAGRLLPEQSLHRLPHLAQVRRFGSPSLLLAWAPLVGDA
LCVAAGWLRLPWLPCTLFIAAGKLARYWVVAQGLALLAS