Protein Info for Dsui_0727 in Dechlorosoma suillum PS

Annotation: putative integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details PF04892: VanZ" amino acids 24 to 131 (108 residues), 46.7 bits, see alignment E=2.4e-16

Best Hits

KEGG orthology group: None (inferred from 61% identity to dar:Daro_4156)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH44 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Dsui_0727 putative integral membrane protein (Dechlorosoma suillum PS)
MFSRPGTVLARYLALAYVLLVIYASLHPFAGWRDLGLSPFAFLEAGWPRYWTAFDLVVNV
GVYLPLGFLLALALPMPVLPRLLPSLLAVLLGSGLSFGLESVQTWLPSRVPSNLDLACNA
LGALLGALAAFFHGERLFLRLTHWHGRLVADLPHAELGAVLLGLWLVTQLSPETLLFGSG
DLRSLLGLPLAVPFDPPVFQLVEALIVGASVVALGLFARTLLAPRWPAWVGPPLLILAAL
GVKSLALAVLVSPGDAFIWWSEGARLGLLWGGIVLAVLAWLPPNWRIVLAGLALMAATVL
VNLAPENPYSAAALAAWRQGHFFNFNGLTRLTAALWPFVALPYLMLLGRRL