Protein Info for Dsui_0725 in Dechlorosoma suillum PS

Annotation: putative hydrolase of the alpha/beta superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF12146: Hydrolase_4" amino acids 42 to 141 (100 residues), 39.3 bits, see alignment E=1.5e-13 PF02129: Peptidase_S15" amino acids 44 to 122 (79 residues), 24.5 bits, see alignment E=6.1e-09 PF00561: Abhydrolase_1" amino acids 44 to 140 (97 residues), 40.9 bits, see alignment E=5.8e-14 PF03959: FSH1" amino acids 75 to 194 (120 residues), 21.9 bits, see alignment E=3.7e-08 PF00975: Thioesterase" amino acids 96 to 175 (80 residues), 31.2 bits, see alignment E=8.2e-11

Best Hits

KEGG orthology group: K07018, (no description) (inferred from 71% identity to app:CAP2UW1_3575)

Predicted SEED Role

"Alpha/beta hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH42 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Dsui_0725 putative hydrolase of the alpha/beta superfamily (Dechlorosoma suillum PS)
MRVEPELLLLDGPAGKIEVILENPGAPKGIALIGHPHPLFGGANTNKVAQTLARTLVQLG
YAALRPNFRGVGQSEGSHDEGQGESDDMLAVLDYAKERFGHLPVVLAGFSFGAYVQAKVA
ARLAEAGHPAQRLVLVGTASGHVEGARQYNTSAVAPDTIVIHGSKDETVPLENVLAWAEP
MDLPVVVVAGADHFFHRRLHVLKDIITRAWKH