Protein Info for Dsui_0719 in Dechlorosoma suillum PS

Annotation: uncharacterized protein involved in tolerance to divalent cations

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF03091: CutA1" amino acids 12 to 108 (97 residues), 119.7 bits, see alignment E=2e-39

Best Hits

Swiss-Prot: 48% identical to CUTA_THET8: Divalent-cation tolerance protein CutA (cutA) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: K03926, periplasmic divalent cation tolerance protein (inferred from 61% identity to azo:azo0322)

Predicted SEED Role

"Periplasmic divalent cation tolerance protein cutA" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH36 at UniProt or InterPro

Protein Sequence (113 amino acids)

>Dsui_0719 uncharacterized protein involved in tolerance to divalent cations (Dechlorosoma suillum PS)
MTTSKKANPVLLVQTNCPDGETAARLAAALVDARLAACANVLAPCASIYRWQGKVEMATE
TPLQLKTAADRFPELRARLLELHPYDVPEIVAWPVAEGLPDYLNWVVTETRPE