Protein Info for Dsui_0718 in Dechlorosoma suillum PS

Annotation: thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 173 to 205 (33 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 296 to 326 (31 residues), see Phobius details amino acids 333 to 358 (26 residues), see Phobius details amino acids 373 to 391 (19 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 427 to 448 (22 residues), see Phobius details PF11412: DsbD_N" amino acids 29 to 140 (112 residues), 109.3 bits, see alignment E=3.7e-35 PF02683: DsbD_TM" amino acids 173 to 391 (219 residues), 328.7 bits, see alignment E=4.3e-102 PF13386: DsbD_2" amino acids 180 to 378 (199 residues), 33.4 bits, see alignment E=1.3e-11 PF00085: Thioredoxin" amino acids 483 to 564 (82 residues), 29.5 bits, see alignment E=1.9e-10 PF13899: Thioredoxin_7" amino acids 489 to 564 (76 residues), 47.3 bits, see alignment E=5.8e-16 PF13098: Thioredoxin_2" amino acids 492 to 587 (96 residues), 41.2 bits, see alignment E=5.3e-14

Best Hits

KEGG orthology group: K04084, thiol:disulfide interchange protein DsbD [EC: 1.8.1.8] (inferred from 71% identity to app:CAP2UW1_3579)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH35 at UniProt or InterPro

Protein Sequence (594 amino acids)

>Dsui_0718 thiol:disulfide interchange protein (Dechlorosoma suillum PS)
MIASLIFPLWRWLLPCLILLGLALPVAAQEFLDPLVAFKPEARALDDKTVEVRYSIAKGY
YLYRDKFRFAAEGATLGTPVFPAGKQKHDDNFGDVEVYYKSVAIRLPLSANQSGPITLKV
TAQGCADAGVCYPPQEQKLSVTLPAPGSAPAAVPDAAGDESGHIAGLLQNAGFWLAVSTF
FGFGLLLALTPCVFPMIPILSGIIVGQGHHVSRSKSFLLSLAYVLGMAVTYAALGVVAGL
TGTLLSAALQNPWVLGAFAAVFVVLSFSMFGFYELQLPSFLQSKLSEEASHLHGGHLAAV
FAMGALSAVIVGPCVAAPLAGALLYIGQSGDAVLGGAALFAMALGMGVPLLLVGLSATTL
LPRSGPWMEAVKKAFGVILLGTALWLVSPVLPAALVMAGWALLLIVPAVFMHALDPLPAT
AKGWQRFWKGIGIVMLLAGAALVVGLAAGSRDPLQPLKGVVAANAAAGGGAEAPALPFVR
VKSVADLEARVKAAGKPVMLDFYADWCVSCKEMERFTFADPKVRAKLAGFTLLQADVTAN
SEDDKALLQRFKLFGPPGIIFFDAAGQEIAGLRVVGFQEATPFLQVLQRVAPGA