Protein Info for Dsui_0717 in Dechlorosoma suillum PS

Annotation: GTP cyclohydrolase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00505: GTP cyclohydrolase II
  • amino acids 13 to 201 (189 residues), 248.8 bits, E=1.4e-78
• PF00925: GTP_cyclohydro2
  • amino acids 14 to 177 (164 residues), 226.1 bits, E=9.7e-72

Best Hits

Swiss-Prot: 66% identical to RIBA_AZOVD: GTP cyclohydrolase-2 (ribA) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 72% identity to eba:ebA3120)

MetaCyc: 62% identical to GTP cyclohydrolase 2 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• toxoflavin biosynthesis (3/7 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

See G8QH34 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Dsui_0717 GTP cyclohydrolase II (Dechlorosoma suillum PS)
MTSTPSLPAVALVASCELPTPWAVFRLHGFQETASGKEHLALTLGQVGDGVPALTRLHSE
CLTGDGLFSLRCDCGPQLEAALAAIAKEGRGVLLYLRQEGRGIGLLDKLRAYALQDQGLD
TVDANRALGLPDDARDYGVAAAMLNTLGVPAVRLMTNNPAKVSALTARGVNVTERVPHVA
GRGPRNQDYLETKAARMGHLLPWLEQD