Protein Info for Dsui_0711 in Dechlorosoma suillum PS

Annotation: phosphatidylglycerophosphatase A-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 12 to 19 (8 residues), see Phobius details transmembrane" amino acids 20 to 32 (13 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details PF04608: PgpA" amino acids 20 to 164 (145 residues), 121.7 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 39% identical to PGPA_ECOLI: Phosphatidylglycerophosphatase A (pgpA) from Escherichia coli (strain K12)

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 67% identity to app:CAP2UW1_4315)

MetaCyc: 39% identical to phosphatidylglycerophosphatase A (Escherichia coli K-12 substr. MG1655)
Phosphatidylglycerophosphatase. [EC: 3.1.3.27]

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH28 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Dsui_0711 phosphatidylglycerophosphatase A-like protein (Dechlorosoma suillum PS)
MTTSVRPDLRFLFSHPAHFVACGLGSGLSRFAPGTAGTLFSWAVYSLIRPNFDEIGFLVF
LLVCFVGGVLACHRTGRDLGVVDHGSIVWDEIVPFWLVLFFCPVGQFWWQTALWQTTAFL
LFRIYDIFKPYPANYFDEQVKNGFGVMMDDVFAGLYTILSLAVLHFVLGRLL