Protein Info for Dsui_0707 in Dechlorosoma suillum PS

Annotation: protein RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR02012: protein RecA" amino acids 4 to 325 (322 residues), 564.3 bits, see alignment E=4.2e-174 PF00154: RecA_N" amino acids 7 to 269 (263 residues), 472.4 bits, see alignment E=1e-145 PF08423: Rad51" amino acids 39 to 232 (194 residues), 34 bits, see alignment E=4.8e-12 PF27531: MT3502_N" amino acids 53 to 152 (100 residues), 27.3 bits, see alignment E=8.9e-10 PF21096: RecA_C" amino acids 272 to 328 (57 residues), 88.9 bits, see alignment E=4.6e-29

Best Hits

Swiss-Prot: 86% identical to RECA_DECAR: Protein RecA (recA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03553, recombination protein RecA (inferred from 86% identity to dar:Daro_4152)

MetaCyc: 73% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH24 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Dsui_0707 protein RecA (Dechlorosoma suillum PS)
MDDNKAKALTAALAQIEKQFGKGAIMKMGETEVDKGVDVVSTGSLGLDVALGVGGLPRGR
VVEIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDPQYAQKLGVNIGELLISQPD
NGEQALEIADMLVRSGGVDVIVVDSVAALTPKAEIEGEMGDSMMGLHARLMSQALRKLTA
NIKKTNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGGIKKGDEVIGN
ETRVKVVKNKVSPPFREALFDILYGEGISREGEIIELGVANKLIEKSGAWYSYKGEKIGQ
GKDNSREFLKANPAIAQEIEGKIREALGVANPAPAAAAGE