Protein Info for Dsui_0701 in Dechlorosoma suillum PS

Annotation: serine kinase of the HPr protein, regulates carbohydrate metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF02603: Hpr_kinase_N" amino acids 4 to 130 (127 residues), 85.1 bits, see alignment E=4.2e-28 TIGR00679: HPr(Ser) kinase/phosphatase" amino acids 4 to 304 (301 residues), 333.1 bits, see alignment E=7.4e-104 PF07475: Hpr_kinase_C" amino acids 133 to 301 (169 residues), 213.4 bits, see alignment E=1.6e-67

Best Hits

Swiss-Prot: 59% identical to HPRK_AROAE: HPr kinase/phosphorylase (hprK) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K06023, HPr kinase/phosphorylase [EC: 2.7.11.- 2.7.4.-] (inferred from 78% identity to app:CAP2UW1_4306)

Predicted SEED Role

"HPr kinase/phosphorylase (EC 2.7.1.-) (EC 2.7.4.-)" in subsystem Mannitol Utilization (EC 2.7.1.-, EC 2.7.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.4.-

Use Curated BLAST to search for 2.7.1.- or 2.7.11.- or 2.7.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH18 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Dsui_0701 serine kinase of the HPr protein, regulates carbohydrate metabolism (Dechlorosoma suillum PS)
MRQISISQLFEDHQDKLSLTWVAAQGAERSIEIRERGNYGADVVGHLNLIHPERLQVIGA
AEYQWLSRVNPERLKAQMNEIFAAQPPAVIVAEGLEVLPAVLEGCESTGTPLFTTAKPCS
AVIDLLRIYLSRRLADTVSVHGVFMDVLGMGVLITGDSGVGKSELALELISRGHGLVADD
VVELARIAPATIEGRCPGMLRDFLEVRGLGLLNIRTIFGETASRRKMKLKLIVHLQKPVA
GVDAPRLPLDAQTQEILGVAVRKVVIPVAAGRNLAVLLEAAVRNSILQLRGIDNMQEFIT
RQQKLLLDDDI