Protein Info for Dsui_0683 in Dechlorosoma suillum PS

Annotation: soluble lytic murein transglycosylase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF14718: SLT_L" amino acids 414 to 471 (58 residues), 25.7 bits, see alignment 1.6e-09 PF01464: SLT" amino acids 492 to 596 (105 residues), 87.2 bits, see alignment E=9.2e-29 PF27553: SLT_superhelical" amino acids 606 to 632 (27 residues), 46.5 bits, see alignment (E = 3.8e-16)

Best Hits

KEGG orthology group: K08309, soluble lytic murein transglycosylase [EC: 3.2.1.-] (inferred from 63% identity to app:CAP2UW1_0264)

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGL3 at UniProt or InterPro

Protein Sequence (662 amino acids)

>Dsui_0683 soluble lytic murein transglycosylase-like protein (Dechlorosoma suillum PS)
MSPSPARPRFALRLTLCSALLGLCLGLNAPARAGSDEQFVAARDAFRAGDLNRLDRLAAE
LRDHELAPYVEYFQIRAQLEKADANTVAALNDFLARQDKTYIAEKLRGDWLRLLGKQQRW
SEFEAEYPKISQADQDLACLSLQSRLARKDPKALDDALPLFRTLLEVPEPCNPVLDAVVA
AQKVNSDDVWARIRRQFEINKLGAAWNTAQYLPVAQTPERKLWDQVTDKPLPFLVKLSGT
SQRLQRELALLALQRVARNDPAMAAQRLDALESQLPPADRAWAWGQIGWQGAQRHYPEAL
DWYRRGSDLTPLSDEAQAWKVRAALRAQDWHLVRHAIEGMSPTQAADPSWTYWLGRAYKA
AGRNDLAQPLFERIAGQPNFYGNLADDELGRPIKLPPQARPLSREELARVGDNLALRRAL
ALFRANLRFEGTKEWSWALRGMDDRELLAAAEIARRNNIYDRAIAAADRTKNEHDYSLRY
LSPFDEQVRPVARQQQLDDAWVYGLMRQESRFVTNARSSVGASGLMQLMPATARWVAKKI
GLKDYDHGQVTNTDTNVLLGTSYMRMVMESLDNHPVLASAAYNAGPGRAQKWRDAKPIEG
AIYAETIPFSETRDYVKKVMSNSVYYASLFNNGRPQSLKSRLGVVLPKGSGGENQPKPED
LP