Protein Info for Dsui_0675 in Dechlorosoma suillum PS

Annotation: putative dithiol-disulfide isomerase involved in polyketide biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 51 to 195 (145 residues), 27.7 bits, see alignment E=4.3e-10 PF01323: DSBA" amino acids 55 to 195 (141 residues), 66 bits, see alignment E=6.1e-22

Best Hits

Swiss-Prot: 36% identical to DSBA_BORA1: Thiol:disulfide interchange protein DsbA (dsbA) from Bordetella avium (strain 197N)

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 56% identity to dar:Daro_3864)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGK5 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Dsui_0675 putative dithiol-disulfide isomerase involved in polyketide biosynthesis (Dechlorosoma suillum PS)
MTQTSASLYSRLRRWLAPLALLAAAALQPAVAQQQPQFQAINPPIATDSGSKIEVIEFFS
YGCPHCADFNPLIHAWASRLGPDVAFKKVPITFGRPAWTNVAKLYYALETTGDLAKLDEA
VFKAIHEQRVNLFDPRTAEEWVGKQGADGKKFAEAFASFGVNSKMSRAEQIARAYKVDGV
PMVVVDGRYVVKGEAFKDVLRNADLLIEKIRAERAGKKK