Protein Info for Dsui_0668 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 906 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 331 to 354 (24 residues), see Phobius details amino acids 366 to 383 (18 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 421 to 439 (19 residues), see Phobius details amino acids 445 to 460 (16 residues), see Phobius details amino acids 472 to 489 (18 residues), see Phobius details amino acids 495 to 514 (20 residues), see Phobius details amino acids 523 to 541 (19 residues), see Phobius details amino acids 557 to 578 (22 residues), see Phobius details amino acids 586 to 603 (18 residues), see Phobius details amino acids 609 to 628 (20 residues), see Phobius details amino acids 640 to 660 (21 residues), see Phobius details amino acids 672 to 691 (20 residues), see Phobius details amino acids 703 to 725 (23 residues), see Phobius details amino acids 740 to 761 (22 residues), see Phobius details amino acids 772 to 793 (22 residues), see Phobius details amino acids 806 to 829 (24 residues), see Phobius details amino acids 840 to 858 (19 residues), see Phobius details amino acids 865 to 885 (21 residues), see Phobius details PF10101: DUF2339" amino acids 144 to 888 (745 residues), 438.6 bits, see alignment E=2.9e-135

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGJ9 at UniProt or InterPro

Protein Sequence (906 amino acids)

>Dsui_0668 putative membrane protein (Dechlorosoma suillum PS)
MWLLGVVIGLIIGSPLGSFGSLAGALAGGLIGHWLGRQGNKREPAVGPDFRQRLQLLENQ
VQALRREVEVLKGTATASTAVAESSWETPAPTSPVPQAVQAPPVAMPPQPAPLADSPPPA
ARPVTGQPFTLEPPDWARRLWAINPLAKIGIVLLFFGIASGLRLAVDYGLLPVPLRLLIA
AASGIAMIAFGWNRAGEEKHRTFGQALQGGGFALLYLVAYFMLQRYTMIGQGPAFALFAL
LGIACVFLAARQDAPVLAVLGLSGAFLAPILAGGQADSPLPLFAYFTLLNVFILAVDWFR
AWRVLNIAGFFFTLAVGMAWAMGGYQPRHYLLTQAFLVLFLSVYSAMPVATALLRAPGLA
AWRDGILLFGTPLAGTFLQARLMEGERYGLAWSTLIAALWYFGLWALLFRRREPANLLVE
RSHLGIAVVFLTIAIPLAFDAQVTSAFWAAEGAAVLWFGVRQERKLAQVSGFLMQLAAGL
SLLLGWAALGHRLPVANDAMLGAFILVLAGLFSARQLRSRASSAALLPFLPWAWAMLWWL
GPGLDEIYRFAPDSLHAPYALLFITATVLLQEGLISLWRWPQLRPAAVLLLVGLVVATLA
GIGRHGHPLAGFMALVLPLALAVHYVLLARHERQGETGLAAIRHLGAWWLLLFALAWELA
WQARHLMPAPTLWSFVAVVLVLAAGLALPVLGQQRQRWPFTAAGAGYIPYGVLPPLFGLL
LLLPWGNLRLSGLDGLGWPYLPLLNIFDAGQLAALGALVLLGRQLAAAVAPLLRVLTALL
AFLWLSALAARIAHHWGGIPFNFPTLMHATLFQALLTLFWSTTAIATMIHASRRELRHRW
FGGMLLLGLVGAKLLLFDTMGRGTLTWTATLIGVALLVLAAGYFAPLPPKAAADGPLESD
TLPGIT