Protein Info for Dsui_0665 in Dechlorosoma suillum PS

Annotation: polyphosphate kinase 2, PA0141 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR03707: polyphosphate kinase 2" amino acids 144 to 370 (227 residues), 393.5 bits, see alignment E=1.7e-122 PF03976: PPK2" amino acids 145 to 369 (225 residues), 351.2 bits, see alignment E=1.3e-109

Best Hits

KEGG orthology group: None (inferred from 78% identity to tmz:Tmz1t_2513)

Predicted SEED Role

"Polyphosphate kinase 2 (EC 2.7.4.1)" (EC 2.7.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.1

Use Curated BLAST to search for 2.7.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGJ6 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Dsui_0665 polyphosphate kinase 2, PA0141 family (Dechlorosoma suillum PS)
MVTKVSKPATRKSAALGNTAPKAATKVVAKPRPSRARPVKSGDVAPAHSPAGVESFEVGQ
AVAAAQNSKVVAMRDILSRTQGTDLKSVAKTLEAIVAGASPDDVKMLRDTLFKDEVPADK
LPVSPDDQLSDEWRTGGYPYKNLMTRKNYEKQKYRLQVELLKLQAWVKETGQRVVILFEG
RDAAGKGGAIKRFTEHLNPRGARVVALEKPSEVERGQWYFQRYIQHLPTAGEIVMFDRSW
YNRAGVERVMGFCDQDEYAEFMRQCPEFERNLARSGIHLIKFWFSVSRAEQRRRFKERET
HPLKQWKLSPIDLASLDKWEDYTKAKEAMFFYTDTADSPWTVVKSDCKKRARLNAMRYIL
HKLPYKNKDVERIGPLDPLLVGRANVVYERGEHEGTAIL