Protein Info for Dsui_0664 in Dechlorosoma suillum PS

Annotation: glutamate-1-semialdehyde-2,1-aminomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 TIGR00713: glutamate-1-semialdehyde-2,1-aminomutase" amino acids 5 to 424 (420 residues), 609.3 bits, see alignment E=1.5e-187 PF00202: Aminotran_3" amino acids 34 to 390 (357 residues), 245.6 bits, see alignment E=3.9e-77

Best Hits

Swiss-Prot: 76% identical to GSA_DECAR: Glutamate-1-semialdehyde 2,1-aminomutase (hemL) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01845, glutamate-1-semialdehyde 2,1-aminomutase [EC: 5.4.3.8] (inferred from 79% identity to app:CAP2UW1_3582)

MetaCyc: 59% identical to glutamate-1-semialdehyde 2,1-aminomutase subunit (Salmonella enterica enterica serovar Typhimurium)
Glutamate-1-semialdehyde 2,1-aminomutase. [EC: 5.4.3.8]

Predicted SEED Role

"Glutamate-1-semialdehyde aminotransferase (EC 5.4.3.8)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 5.4.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGJ5 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Dsui_0664 glutamate-1-semialdehyde-2,1-aminomutase (Dechlorosoma suillum PS)
MSSRNQQLFDAAQRHIPGGVNSPVRAFRSVGGAPRFFTRGEGPRVWDAEGKSYLDYVGSW
GPLILGHAHAPTVKAVQEAAALGLSFGAPTEAEIEIADLLCDILPSLDMVRLVSSGTEAT
MSAIRLARGHTGRDLLVKFEGCYHGHSDSLLVKAGSGLLTFGNPSSGGVPADVAKHTLVL
EYNNAEQLAEAFAKQGSEIAAVIVEPVAGNMNLIAPKPEFMQAMRELCSKHGAVLIFDEV
MTGFRVGPQCAQGLFGITPDLTTLGKVIGGGMPVAAFGGKREIMEKIAPLGPVYQAGTLS
GNPVAVAAGLVTLKATRAPGFYDSLAARTKQLTDGLTAAAKKHGVTFCAQSVGGMFGLYF
SATPPTSFAEVMQCDKEAFNRFFHAMLEAGHYLAPSAFEAGFVSAAHTEADIAATIAAAE
AIFAKGV