Protein Info for Dsui_0655 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details PF09997: DUF2238" amino acids 9 to 198 (190 residues), 220.8 bits, see alignment E=5.7e-70

Best Hits

Swiss-Prot: 67% identical to YJDF_ECOLI: Inner membrane protein YjdF (yjdF) from Escherichia coli (strain K12)

KEGG orthology group: K08984, putative membrane protein (inferred from 70% identity to aha:AHA_3228)

Predicted SEED Role

"Inner membrane protein yjdF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGI6 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Dsui_0655 putative membrane protein (Dechlorosoma suillum PS)
MTSSRTALLLLLAAATLALLGLTGYRPYDRATWLLEVLPVLIALPLLALTWRRYPLTTLL
YVCIFIHGVILMVGGMYTYARVPVGFQVAEWLHLQRNPYDKLGHLFQGFAPALIAREILL
RGAYVRGRKMLFFLVTCVVLAISATYELLEWWTALAFGQGADDFLGTQGDPWDTQSDMFC
ALLGALLAQLGLARWQDRQIAALPRPKA