Protein Info for Dsui_0653 in Dechlorosoma suillum PS

Annotation: putative SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF17785: PUA_3" amino acids 4 to 67 (64 residues), 65.9 bits, see alignment E=3.4e-22 PF10672: Methyltrans_SAM" amino acids 170 to 350 (181 residues), 80.5 bits, see alignment E=1.8e-26 PF03602: Cons_hypoth95" amino acids 219 to 302 (84 residues), 34.2 bits, see alignment E=3.1e-12

Best Hits

Swiss-Prot: 53% identical to RLMI_KLEP3: Ribosomal RNA large subunit methyltransferase I (rlmI) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 76% identity to tmz:Tmz1t_1911)

MetaCyc: 51% identical to 23S rRNA m5C1962 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11602 [EC: 2.1.1.191]

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGI4 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Dsui_0653 putative SAM-dependent methyltransferase (Dechlorosoma suillum PS)
MSQLILFPGKERSLLRRHPWIFAGSVGRLKGKARPGDTVEVLADDGKFLARAAYSPDSQI
RARVWTFNENETIDDVFFKRRIAEAVARRRNLPELKNEEGVRLLHGESDGLPGVVCDQYG
DTLSLQLTSAGGEKWRKAIVNALVQATGCARIYERSDSDVRRLEGLEPVTGWLHGEAPAG
DLSIMENGVRLLVDVVGGHKTGFYLDQRENRLLTGALAAGKSVLNCFCYTGGFSLQALAG
GAASVLSIDSSGPALETAKRNVTLNPQLDAARAEWWEADVFTALRELRKAERKFDLIVLD
PPKFAPSAAHADRAARAYKDINLLGFRLLNPGGLLFTYSCSGGIGNELFQKIIAGAALDA
GVDARILRHLAAGPDHPIALAVPEGEYLKGLLCQV