Protein Info for Dsui_0652 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 163 to 184 (22 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 357 to 374 (18 residues), see Phobius details PF01988: VIT1" amino acids 161 to 371 (211 residues), 212.4 bits, see alignment E=3.7e-67

Best Hits

KEGG orthology group: None (inferred from 56% identity to ttr:Tter_2551)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGI3 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Dsui_0652 putative membrane protein (Dechlorosoma suillum PS)
MAKPDPRQDLSRYRRNQQGEVDSAALYQAMAEAETKPELAAIYRRLAAAEAAHAQFWQRR
QERAGQPAPNLGPTWRARILIWLARHLGAASVLPTVAARESLDQTSYDDQRESRHTALPA
QERAHARLLFRLTSMGNGGRWDGGAYARLEGRHGAGGGNALRAAVLGANDGLVSTLSLVM
GVAGAQFSNTAMLATGLAGMLAGACSMAMGEWISVQSSREMYAHQIAAEAEELAEVPAEE
QAELALIYQAKGFTAEEAAAIAARVIQNQETALDTLTREELGINPDDLGGSAGTAALASF
AVFLVGALIPILPLLFLQGRAAVMGSAVASALGLFLIGAAISIFTGRHPGRAGMRQLLIG
MAAAAVTYGAGSAVEA