Protein Info for Dsui_0646 in Dechlorosoma suillum PS

Annotation: Lauroyl/myristoyl acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 5 to 281 (277 residues), 116.9 bits, see alignment E=5.2e-38

Best Hits

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 64% identity to app:CAP2UW1_4196)

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGH7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Dsui_0646 Lauroyl/myristoyl acyltransferase (Dechlorosoma suillum PS)
MSLLFRLLACLPLAWLHALGALLGRLVYRLSATYRSHLQQNLALAYPADAATDLIPAIAR
EAGKGVLELPKVWLRPLEEVAARVVQVSGWELVEAAWAEDEGIIFLTPHLGCFEITAQYY
ARQAVRARPAAPITVLFRPPKLEWLGRIIAAGRARGEHLKLAPADLSGVRALIRALKRKE
AVGLLPDQAPSAGEGKWLPFFGRPAYTMTLAARLSEAGGRVIFAYGERLPHGRGYHLHLQ
APTQPLTGDTVARAAQINRELETLIRQCPSQYLWGYNRYKRPRGAEPAPTAAEDCR