Protein Info for Dsui_0638 in Dechlorosoma suillum PS

Annotation: ABC-type polar amino acid transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00005: ABC_tran" amino acids 18 to 165 (148 residues), 122.5 bits, see alignment E=3.1e-39

Best Hits

Swiss-Prot: 79% identical to GLTL_ECO57: Glutamate/aspartate import ATP-binding protein GltL (gltL) from Escherichia coli O157:H7

KEGG orthology group: K10004, glutamate/aspartate transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 90% identity to azo:azo0439)

MetaCyc: 79% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport ATP-binding protein GltL (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGG9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Dsui_0638 ABC-type polar amino acid transport system, ATPase component (Dechlorosoma suillum PS)
MIEIKNVSKWYGQFQVLTDCTTEVKKGEVVVVCGPSGSGKSTLIKCVNGLEPFQQGDIVV
NGTSVGDPRTNLSKLRSHVGMVFQHFELFPHMTITDNLTIAQVKVLGRSREEATDKGLKL
LDRVGLKAHAHKHPGQLSGGQQQRVAIARALAMDPICMLFDEPTSALDPEMINEVLDVMV
ELAQEGMTMMCVTHEMGFARKVAHRVIFMDQGRIVEDAAKDDFFGKPHSERAQQFLAKIL
QH