Protein Info for Dsui_0637 in Dechlorosoma suillum PS

Annotation: amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 53 to 78 (26 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 117 (105 residues), 78.7 bits, see alignment E=1.9e-26 PF00528: BPD_transp_1" amino acids 34 to 223 (190 residues), 85.2 bits, see alignment E=2.5e-28

Best Hits

Swiss-Prot: 63% identical to GLTK_ECO57: Glutamate/aspartate import permease protein GltK (gltK) from Escherichia coli O157:H7

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 75% identity to app:CAP2UW1_1095)

MetaCyc: 63% identical to glutamate/aspartate ABC transporter membrane subunit GltK (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGG8 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Dsui_0637 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (Dechlorosoma suillum PS)
MYEFDWSSIPGALPLLGKGLLVTLEVTLTAIVVGIGWGTLLAVARLSSNRLLSFLAAGYV
NLFRSVPLVMVILWFYLIVPQALKGLFGQDIGDIRLVSALVAFALFEAAYYSEIIRAGIQ
SVPKGQVAAGLALGLTPGQTMRLVVLPQAFRNMIPLLLTQAIILFQDTSLVYVIGLSDFF
GTAYKVGDRDGRLVELLLFAGAAYFVICFTVSRLVKHLQARFIK