Protein Info for Dsui_0631 in Dechlorosoma suillum PS

Annotation: cytochrome c551/c552

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00034: Cytochrom_C" amino acids 25 to 102 (78 residues), 41 bits, see alignment E=2e-14

Best Hits

Swiss-Prot: 61% identical to CY552_HYDTT: Cytochrome c-552 (HTH_0988) from Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)

KEGG orthology group: None (inferred from 64% identity to dar:Daro_3321)

Predicted SEED Role

"Cytochrome c551/c552" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGG2 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Dsui_0631 cytochrome c551/c552 (Dechlorosoma suillum PS)
MKAIYVSLLAAAGLLINGAAQADEALAKAKNCMTCHQIATKVVGPAYKDVAKKYAGDKAA
EGKLAEKIQKGGSGAWGTVPMPPNNVTPDEAKKLAHWVLSLK