Protein Info for Dsui_0629 in Dechlorosoma suillum PS

Annotation: branched-chain amino acid ABC-type transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 291 (284 residues), 158.8 bits, see alignment E=7.6e-51

Best Hits

Swiss-Prot: 50% identical to BRAD_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraD (braD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 73% identity to gca:Galf_0302)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGG0 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Dsui_0629 branched-chain amino acid ABC-type transport system, permease component (Dechlorosoma suillum PS)
MDIFLQQIINGLVLGSIYALVALGYTMVYGILGLINFAHGEVVMIGALTALTVVKLLAGS
GLPGPVIALIGLMAAAPVCMAIGYGIEKIAYRPLRKAPRLAPLITAIGVSIVLQNLAMMV
WGRSYHSFPAVLPAEAHEVLGATFTDLQVIIVLVAAGMMAGLLLLINRTRLGRAMRATAE
NPAIAQLMGVNVNHIISLTFVIGSALAAVAGLMVSANYSIAHYYMGFILGLKAFTAAVLG
GIGNLAGAMIGGILLGLIESLGAGYIGDITGGFLGSHYQDVFAFFVLILVLVFRPSGLVG
EKVAERA