Protein Info for Dsui_0628 in Dechlorosoma suillum PS

Annotation: ABC-type branched-chain amino acid transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 270 to 297 (28 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 336 (297 residues), 169.2 bits, see alignment E=5.4e-54

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 72% identity to slt:Slit_2690)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGF9 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Dsui_0628 ABC-type branched-chain amino acid transport system, permease component (Dechlorosoma suillum PS)
MSWNDLKHDRRVLWAGYAAIGIVLAVLPFLVGAGLGNAWLRILNFAMLYIMLALGLNIVV
GFAGLLDLGYIAFYAVGAYLYALLASPHFGLHWPVWAILPLGAVVAGGAGALLGAPTLRL
RGDYLAIVTLGFGEIIRIFMNNLNAPVNITNGPQGISSIDPFHVGGVTLAKPLSVLGVTV
PSLHAYYYLFLLLALVIIFVTIRLEDSRIGRAWVAIREDEIAAKACGINVRNIKLLAFSM
GATFGGVAGGLFASFQGFVSPESFGLMESIMVLCMVVLGGMGHIPGVILGGILLTILPEA
FRHAAVPLQKYAFGKVVVDPESLRMLLFGLALIAVMLYRPAGLWPSATRKRELQGGSK