Protein Info for Dsui_0625 in Dechlorosoma suillum PS

Annotation: putative metal-sulfur cluster biosynthetic enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 PF01883: FeS_assembly_P" amino acids 6 to 69 (64 residues), 65.5 bits, see alignment E=2.2e-22

Best Hits

Swiss-Prot: 45% identical to SUFT_BACSU: Fe-S protein maturation auxiliary factor YitW (yitW) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 54% identity to eba:ebB223)

Predicted SEED Role

"probably aromatic ring hydroxylating enzyme, evidenced by COGnitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG14 at UniProt or InterPro

Protein Sequence (103 amino acids)

>Dsui_0625 putative metal-sulfur cluster biosynthetic enzyme (Dechlorosoma suillum PS)
MSLPTEEALRTVLRQVVDPEVGVNIVDLGLVYGIDIGDNGVVVRLTMTSPACPMGDLVMD
EARAALEPLVPEPYDLDLQLVWEPPWSPALMSPKAKDTLGWGE